Lineage for d6inca_ (6inc A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566316Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 2566317Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 2566343Family d.290.1.0: automated matches [191426] (1 protein)
    not a true family
  6. 2566344Protein automated matches [190613] (7 species)
    not a true protein
  7. 3062124Species Klebsiella pneumoniae [TaxId:573] [362186] (2 PDB entries)
  8. 3062125Domain d6inca_: 6inc A: [362187]
    automated match to d1xv2c_
    complexed with cl, edo, na, zn

Details for d6inca_

PDB Entry: 6inc (more details), 1.6 Å

PDB Description: crystal structure of an acetolactate decarboxylase from klebsiella pneumoniae
PDB Compounds: (A:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d6inca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6inca_ d.290.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
svlyqtslmsallsgvyegsttiadllkhgdfglgtfneldgeliafssqvyqlradgsa
rnaqpeqktpfavmtwfqpqyrktfdhpvsrqqlhevidqqipsdnlfcalridghfrha
htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
kggghlldyqldhgvltfgeihklmidlpadsaflqan

SCOPe Domain Coordinates for d6inca_:

Click to download the PDB-style file with coordinates for d6inca_.
(The format of our PDB-style files is described here.)

Timeline for d6inca_:

  • d6inca_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17