Lineage for d6c5hl1 (6c5h L:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (175 PDB entries)
  8. 3062121Domain d6c5hl1: 6c5h L:1-107 [362183]
    Other proteins in same PDB: d6c5hl2
    automated match to d1blna1
    complexed with cl, fuc, gp1, kdo, nag, peg, pg4, tam, z9m

Details for d6c5hl1

PDB Entry: 6c5h (more details), 1.99 Å

PDB Description: s25-5 fab in complex with chlamydiaceae-specific lps antigen
PDB Compounds: (L:) Fab Light Chain (IgG1 Kappa)

SCOPe Domain Sequences for d6c5hl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c5hl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqsplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleik

SCOPe Domain Coordinates for d6c5hl1:

Click to download the PDB-style file with coordinates for d6c5hl1.
(The format of our PDB-style files is described here.)

Timeline for d6c5hl1:

  • d6c5hl1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17