Lineage for d6geva1 (6gev A:737-984)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (167 PDB entries)
  8. 3062108Domain d6geva1: 6gev A:737-984 [362170]
    Other proteins in same PDB: d6geva2
    automated match to d2ovha_
    complexed with ewn, gol

Details for d6geva1

PDB Entry: 6gev (more details), 1.54 Å

PDB Description: mineralocorticoid receptor in complex with (s)-13
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d6geva1:

Sequence, based on SEQRES records: (download)

>d6geva1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d6geva1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreskvefpamlveiisdqlpkvesgnakpl
yfhrk

SCOPe Domain Coordinates for d6geva1:

Click to download the PDB-style file with coordinates for d6geva1.
(The format of our PDB-style files is described here.)

Timeline for d6geva1:

  • d6geva1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17