Lineage for d6gtyd_ (6gty D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2363802Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2363981Protein automated matches [190569] (9 species)
    not a true protein
  7. 2364009Species Escherichia coli [TaxId:83333] [269237] (12 PDB entries)
  8. 3062101Domain d6gtyd_: 6gty D: [362163]
    automated match to d5ab1a_
    complexed with man, mma

Details for d6gtyd_

PDB Entry: 6gty (more details), 1.9 Å

PDB Description: crystal structure of the fimh lectin domain from e.coli k12 in complex with the dimannoside man(alpha1-6)man
PDB Compounds: (D:) Type 1 fimbrin D-mannose specific adhesin

SCOPe Domain Sequences for d6gtyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtyd_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d6gtyd_:

Click to download the PDB-style file with coordinates for d6gtyd_.
(The format of our PDB-style files is described here.)

Timeline for d6gtyd_:

  • d6gtyd_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17