SCOPe 2.08: Domain d6h3pa_: 6h3p A:

Lineage for d6h3pa_ (6h3p A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.0: automated matches [237401] (1 protein)
   not a true family

6. Protein automated matches [237402] (7 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [362160] (2 PDB entries)

8. Domain d6h3pa_: 6h3p A: [362161]
   automated match to d4ppua_

Details for d6h3pa_

PDB Entry: 6h3p, 2.7 Å

PDB Description: crystal structure of the cytoplasmic chorismate mutase from zea mays

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d6h3pa_:

Sequence; same for both SEQRES and ATOM records:

>d6h3pa_ a.130.1.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
lslaavrdalvrledsvvfalierarhprnapayapaatagehslveffvreaealnaka
ghyqkpedvpffpqdlpsplfptkpspkvlhpfaslvtvndaiwkmyfdellplftvdgd
dasyaqtvaldlaclqvlsqrihigkyvaevkfkdapqeysrlikekdsnslmdmltfka
veekvkkrvekkartfgqnvtlddnatagdseckvdpkvlsklydqwvmpltkdveveyl
lrrld

Timeline for d6h3pa_:

• d6h3pa_ first appeared in SCOPe 2.07