Lineage for d6gxya1 (6gxy A:2-144)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2456544Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2456952Protein automated matches [190100] (20 species)
    not a true protein
  7. 3062089Species Trypanosoma brucei [TaxId:5702] [362151] (2 PDB entries)
  8. 3062095Domain d6gxya1: 6gxy A:2-144 [362157]
    Other proteins in same PDB: d6gxya2, d6gxyb2, d6gxyc2
    automated match to d1o73a_
    complexed with ffn

Details for d6gxya1

PDB Entry: 6gxy (more details), 1.8 Å

PDB Description: tryparedoxin from trypanosoma brucei in complex with cft
PDB Compounds: (A:) tryparedoxin

SCOPe Domain Sequences for d6gxya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gxya1 c.47.1.10 (A:2-144) automated matches {Trypanosoma brucei [TaxId: 5702]}
sglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhhvak
nfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinadtga
iigtqartrviedpdganfpwpn

SCOPe Domain Coordinates for d6gxya1:

Click to download the PDB-style file with coordinates for d6gxya1.
(The format of our PDB-style files is described here.)

Timeline for d6gxya1:

  • d6gxya1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17