Lineage for d6gg8a_ (6gg8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (161 PDB entries)
  8. 3062094Domain d6gg8a_: 6gg8 A: [362156]
    automated match to d1m2za_
    complexed with ey8, mpd

Details for d6gg8a_

PDB Entry: 6gg8 (more details), 1.8 Å

PDB Description: mineralocorticoid receptor in complex with (s)-13
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d6gg8a_:

Sequence, based on SEQRES records: (download)

>d6gg8a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d6gg8a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtksswqrfy
qltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
rk

SCOPe Domain Coordinates for d6gg8a_:

Click to download the PDB-style file with coordinates for d6gg8a_.
(The format of our PDB-style files is described here.)

Timeline for d6gg8a_:

  • d6gg8a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17