Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
Protein automated matches [190284] (9 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [259256] (9 PDB entries) |
Domain d6fgda2: 6fgd A:499-653 [362149] Other proteins in same PDB: d6fgda1, d6fgda3 automated match to d2ftsa3 complexed with act, adp, ca, d8z, mpd, na, po4 |
PDB Entry: 6fgd (more details), 1.5 Å
SCOPe Domain Sequences for d6fgda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fgda2 c.57.1.0 (A:499-653) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr kiifalpgnpvsavvtcnlfvvpalrkmqgildpr
Timeline for d6fgda2: