Lineage for d6fgda2 (6fgd A:499-653)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890248Species Norway rat (Rattus norvegicus) [TaxId:10116] [259256] (9 PDB entries)
  8. 2890250Domain d6fgda2: 6fgd A:499-653 [362149]
    Other proteins in same PDB: d6fgda1, d6fgda3
    automated match to d2ftsa3
    complexed with act, adp, ca, d8z, mpd, na, po4

Details for d6fgda2

PDB Entry: 6fgd (more details), 1.5 Å

PDB Description: crystal structure of gephyrin e domain in complex with artemether
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d6fgda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgda2 c.57.1.0 (A:499-653) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOPe Domain Coordinates for d6fgda2:

Click to download the PDB-style file with coordinates for d6fgda2.
(The format of our PDB-style files is described here.)

Timeline for d6fgda2: