Lineage for d6gtwc_ (6gtw C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2363802Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2363981Protein automated matches [190569] (9 species)
    not a true protein
  7. 2363989Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)
  8. 3062085Domain d6gtwc_: 6gtw C: [362147]
    automated match to d4xocb_
    complexed with ca, man

Details for d6gtwc_

PDB Entry: 6gtw (more details), 2.5 Å

PDB Description: crystal structure of the fimh lectin domain from e.coli f18 in complex with trimannose
PDB Compounds: (C:) FimH PROTEIN

SCOPe Domain Sequences for d6gtwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtwc_ b.2.3.2 (C:) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d6gtwc_:

Click to download the PDB-style file with coordinates for d6gtwc_.
(The format of our PDB-style files is described here.)

Timeline for d6gtwc_:

  • d6gtwc_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17