Lineage for d6ggga_ (6ggg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (161 PDB entries)
  8. 3062072Domain d6ggga_: 6ggg A: [362134]
    automated match to d1m2za_
    complexed with cl, eyn

Details for d6ggga_

PDB Entry: 6ggg (more details), 1.71 Å

PDB Description: mineralocorticoid receptor in complex with (s)-13
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d6ggga_:

Sequence, based on SEQRES records: (download)

>d6ggga_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitliqyswms
llsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrlqltfee
ytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgqswqrfyqltkll
dsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhr

Sequence, based on observed residues (ATOM records): (download)

>d6ggga_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivyagydkpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsll
sfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeyt
imkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgqswqrfyqltkllds
mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfhr

SCOPe Domain Coordinates for d6ggga_:

Click to download the PDB-style file with coordinates for d6ggga_.
(The format of our PDB-style files is described here.)

Timeline for d6ggga_:

  • d6ggga_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17