SCOPe 2.08: Domain d6cxtb2: 6cxt B:229-380

Lineage for d6cxtb2 (6cxt B:229-380)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Marinomonas mediterranea [TaxId:717774] [362050] (2 PDB entries)

8. Domain d6cxtb2: 6cxt B:229-380 [362129]
   Other proteins in same PDB: d6cxtb1
   automated match to d3mpia2
   complexed with edo, fad, fk4

Details for d6cxtb2

PDB Entry: 6cxt, 1.9 Å

PDB Description: crystal structure of fad-dependent dehydrogenase

PDB Compounds: (B:) butyryl-coa dehydrogenase

SCOPe Domain Sequences for d6cxtb2:

Sequence; same for both SEQRES and ATOM records:

>d6cxtb2 a.29.3.0 (B:229-380) automated matches {Marinomonas mediterranea [TaxId: 717774]}
gqgarifaasmdwercclfaifvgamqrdlnqcieyantrmqgdktisrfqavshriadm
gvrlesarlmlyyaawqksqdvdntkavamsklaiseafvqsgidsirvhgalgyldegr
vnnsikdalgsvlfsgtsdiqrelicnrlgll

Timeline for d6cxtb2:

• d6cxtb2 first appeared in SCOPe 2.07