Lineage for d6cxtb1 (6cxt B:1-228)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015737Species Marinomonas mediterranea [TaxId:717774] [362048] (2 PDB entries)
  8. 3015738Domain d6cxtb1: 6cxt B:1-228 [362128]
    Other proteins in same PDB: d6cxtb2
    automated match to d3mpia1
    complexed with edo, fad, fk4

Details for d6cxtb1

PDB Entry: 6cxt (more details), 1.9 Å

PDB Description: crystal structure of fad-dependent dehydrogenase
PDB Compounds: (B:) butyryl-coa dehydrogenase

SCOPe Domain Sequences for d6cxtb1:

Sequence, based on SEQRES records: (download)

>d6cxtb1 e.6.1.0 (B:1-228) automated matches {Marinomonas mediterranea [TaxId: 717774]}
mnfewtheqaelfehalrfgkelsaplqedngfprdnwnalgdfgyfglpipekyakdgs
gfdilttikiieglgqsctdtgllfagaahtfacsmpilehgsetlkhqllpdlatgrki
aanaiseasagsdisnlattaqkegdyyvlnggksyvtngsiadyyvvyattnkkhgylg
qtafvvprntpgisvgndyhklglrsaplnqvffdnctihkdyalgre

Sequence, based on observed residues (ATOM records): (download)

>d6cxtb1 e.6.1.0 (B:1-228) automated matches {Marinomonas mediterranea [TaxId: 717774]}
mnfewtheqaelfehalrfgkelgfprdnwnalgdfgyfglpipekyakdgsgfdiltti
kiieglgqsctdtgllfagaahtfacsmpilehgsetlkhqllpdlatgrkiaanaisea
sagsdisnlattaqkegdyyvlnggksyvtngsiadyyvvyattnkkhgylgqtafvvpr
ntpgisvgndyhklglrsaplnqvffdnctihkdyalgre

SCOPe Domain Coordinates for d6cxtb1:

Click to download the PDB-style file with coordinates for d6cxtb1.
(The format of our PDB-style files is described here.)

Timeline for d6cxtb1: