![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Fibroblast growth factor receptor 1 [56158] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56159] (43 PDB entries) |
![]() | Domain d6c19b_: 6c19 B: [362127] automated match to d4v04b_ complexed with so4, yy7 |
PDB Entry: 6c19 (more details), 2.12 Å
SCOPe Domain Sequences for d6c19b_:
Sequence, based on SEQRES records: (download)
>d6c19b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
>d6c19b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgegqvvlaeaigldkdkpnrvtkvavkmlksdatekdls dlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarreqlsskdlv scayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgllpvkwmapealfdriyt hqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwh avpsqrptfkqlvedldrivalts
Timeline for d6c19b_: