Lineage for d6cwka_ (6cwk A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (47 PDB entries)
  8. 3062063Domain d6cwka_: 6cwk A: [362125]
    automated match to d1mqkh_
    complexed with cl, edo, so4

Details for d6cwka_

PDB Entry: 6cwk (more details), 1.26 Å

PDB Description: anti-rta vhh antibody
PDB Compounds: (A:) Anti-Ricin antibody

SCOPe Domain Sequences for d6cwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cwka_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaesggglvqaggslklscaasgrdfsmymlawfrqapgkerefvaaimcsgggggt
yyadsmqgrftisrdnakktvalqmnslkpedtavyycaasttycsattyssdrlydfwg
qgtqvtvss

SCOPe Domain Coordinates for d6cwka_:

Click to download the PDB-style file with coordinates for d6cwka_.
(The format of our PDB-style files is described here.)

Timeline for d6cwka_:

  • d6cwka_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17