Lineage for d6g48a_ (6g48 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499158Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2499159Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2499160Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2499209Protein automated matches [279671] (1 species)
    not a true protein
  7. 2499210Species Sporosarcina pasteurii [TaxId:1474] [279673] (6 PDB entries)
  8. 3062062Domain d6g48a_: 6g48 A: [362124]
    Other proteins in same PDB: d6g48b_
    automated match to d5g4ha_
    complexed with ag, edo, ni, oh, so4

Details for d6g48a_

PDB Entry: 6g48 (more details), 1.91 Å

PDB Description: sporosarcina pasteurii urease inhibited by silver
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d6g48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g48a_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d6g48a_:

Click to download the PDB-style file with coordinates for d6g48a_.
(The format of our PDB-style files is described here.)

Timeline for d6g48a_:

  • d6g48a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17