Lineage for d6cgea_ (6cge A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427753Protein automated matches [190085] (51 species)
    not a true protein
  7. 2427987Species Human (Homo sapiens) [TaxId:9606] [186828] (30 PDB entries)
  8. 3062060Domain d6cgea_: 6cge A: [362122]
    automated match to d1fdsa_
    complexed with f0d, nap

Details for d6cgea_

PDB Entry: 6cge (more details), 2.2 Å

PDB Description: crystal structure of human 17beta-hsd type 1 in ternary complex with pbrm and nadp+
PDB Compounds: (A:) Estradiol 17-beta-dehydrogenase 1

SCOPe Domain Sequences for d6cgea_:

Sequence, based on SEQRES records: (download)

>d6cgea_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfg

Sequence, based on observed residues (ATOM records): (download)

>d6cgea_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalra
pkptlryftterflpllrmrlddpsgsnyvtamhrevfg

SCOPe Domain Coordinates for d6cgea_:

Click to download the PDB-style file with coordinates for d6cgea_.
(The format of our PDB-style files is described here.)

Timeline for d6cgea_:

  • d6cgea_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17