Class b: All beta proteins [48724] (180 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein automated matches [259253] (1 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (9 PDB entries) |
Domain d6fgca1: 6fgc A:319-498 [362118] Other proteins in same PDB: d6fgca2, d6fgca3 automated match to d2ftsa2 complexed with act, adp, ca, cl, d95, mpd, mrd, po4 |
PDB Entry: 6fgc (more details), 1.5 Å
SCOPe Domain Sequences for d6fgca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fgca1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf
Timeline for d6fgca1: