Lineage for d6d2pl2 (6d2p L:111-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries)
  8. 3062050Domain d6d2pl2: 6d2p L:111-213 [362112]
    Other proteins in same PDB: d6d2pl1
    automated match to d1aqkl2
    complexed with gol

Details for d6d2pl2

PDB Entry: 6d2p (more details), 2.6 Å

PDB Description: crystal structure of ioma-class clk31 fab from an hiv-1 naive donor in complex with a germline-targeting gp120 engineered outer domain eod- gt8 at 2.6 a
PDB Compounds: (L:) IOMAclass naive CLK31 Fab light chain

SCOPe Domain Sequences for d6d2pl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d2pl2 b.1.1.2 (L:111-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d6d2pl2:

Click to download the PDB-style file with coordinates for d6d2pl2.
(The format of our PDB-style files is described here.)

Timeline for d6d2pl2:

  • d6d2pl2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17