Lineage for d6al3b_ (6al3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2339218Protein automated matches [190139] (27 species)
    not a true protein
  7. 3061939Species Protobothrops flavoviridis [TaxId:88087] [362001] (1 PDB entry)
  8. 3062033Domain d6al3b_: 6al3 B: [362095]
    automated match to d1goda_
    complexed with so4

Details for d6al3b_

PDB Entry: 6al3 (more details), 2.57 Å

PDB Description: lys49 pla2 bpii derived from the venom of protobothrops flavoviridis.
PDB Compounds: (B:) Basic phospholipase A2 BP-II

SCOPe Domain Sequences for d6al3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6al3b_ a.133.1.2 (B:) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
tc

SCOPe Domain Coordinates for d6al3b_:

Click to download the PDB-style file with coordinates for d6al3b_.
(The format of our PDB-style files is described here.)

Timeline for d6al3b_:

  • d6al3b_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17