Lineage for d6ch6a_ (6ch6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (43 species)
    not a true protein
  7. 2301596Species Amphitrite ornata [TaxId:129555] [189339] (16 PDB entries)
  8. 3062032Domain d6ch6a_: 6ch6 A: [362094]
    automated match to d5lkva_
    complexed with f0j, gol, hem, so4

Details for d6ch6a_

PDB Entry: 6ch6 (more details), 1.7 Å

PDB Description: dehaloperoxidase b in complex with substrate 2,4-dimethoxyphenol
PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d6ch6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ch6a_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d6ch6a_:

Click to download the PDB-style file with coordinates for d6ch6a_.
(The format of our PDB-style files is described here.)

Timeline for d6ch6a_:

  • d6ch6a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17