Lineage for d6cuha2 (6cuh A:115-190)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries)
  8. 3062030Domain d6cuha2: 6cuh A:115-190 [362092]
    Other proteins in same PDB: d6cuha1, d6cuhb1, d6cuhb2
    automated match to d4eura2
    complexed with act, edo, peg, po4

Details for d6cuha2

PDB Entry: 6cuh (more details), 2.01 Å

PDB Description: crystal structure of the unliganded bc8b tcr
PDB Compounds: (A:) T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR

SCOPe Domain Sequences for d6cuha2:

Sequence, based on SEQRES records: (download)

>d6cuha2 b.1.1.2 (A:115-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanaf

Sequence, based on observed residues (ATOM records): (download)

>d6cuha2 b.1.1.2 (A:115-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksdksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanaf

SCOPe Domain Coordinates for d6cuha2:

Click to download the PDB-style file with coordinates for d6cuha2.
(The format of our PDB-style files is described here.)

Timeline for d6cuha2:

  • d6cuha2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6cuha1