Lineage for d6cuha1 (6cuh A:2-114)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries)
  8. 3062029Domain d6cuha1: 6cuh A:2-114 [362091]
    Other proteins in same PDB: d6cuha2
    automated match to d4eura1
    complexed with act, edo, peg, po4

Details for d6cuha1

PDB Entry: 6cuh (more details), 2.01 Å

PDB Description: crystal structure of the unliganded bc8b tcr
PDB Compounds: (A:) T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR

SCOPe Domain Sequences for d6cuha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuha1 b.1.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg
featyrkettsfhlekgsvqvsdsavyfcaltpsggyqkvtfgtgtklqvipn

SCOPe Domain Coordinates for d6cuha1:

Click to download the PDB-style file with coordinates for d6cuha1.
(The format of our PDB-style files is described here.)

Timeline for d6cuha1:

  • d6cuha1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6cuha2