![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries) |
![]() | Domain d6cuha1: 6cuh A:2-114 [362091] Other proteins in same PDB: d6cuha2 automated match to d4eura1 complexed with act, edo, peg, po4 |
PDB Entry: 6cuh (more details), 2.01 Å
SCOPe Domain Sequences for d6cuha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cuha1 b.1.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg featyrkettsfhlekgsvqvsdsavyfcaltpsggyqkvtfgtgtklqvipn
Timeline for d6cuha1: