SCOPe 2.07: Domain d6cuha1: 6cuh A:2-114

Lineage for d6cuha1 (6cuh A:2-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)

8. Domain d6cuha1: 6cuh A:2-114 [362091]
   Other proteins in same PDB: d6cuha2
   automated match to d4eura1
   complexed with act, edo, peg, po4

Details for d6cuha1

PDB Entry: 6cuh, 2.01 Å

PDB Description: crystal structure of the unliganded bc8b tcr

PDB Compounds: (A:) T-cell Receptor alpha variable, TRAV 9-2. BC8B TCR

SCOPe Domain Sequences for d6cuha1:

Sequence; same for both SEQRES and ATOM records:

>d6cuha1 b.1.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg
featyrkettsfhlekgsvqvsdsavyfcaltpsggyqkvtfgtgtklqvipn

Timeline for d6cuha1:

• d6cuha1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17