Lineage for d6cwga_ (6cwg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557740Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2557741Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2557742Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2557843Protein Ricin A-chain [56389] (1 species)
  7. 2557844Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (49 PDB entries)
    Uniprot P06750 28-286
  8. 3062028Domain d6cwga_: 6cwg A: [362090]
    Other proteins in same PDB: d6cwgb_, d6cwgd_
    automated match to d1br6a_
    complexed with cl

Details for d6cwga_

PDB Entry: 6cwg (more details), 2.6 Å

PDB Description: ricin catalytic subunit bound go a9 vhh antibody
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d6cwga_:

Sequence, based on SEQRES records: (download)

>d6cwga_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcapppssqf

Sequence, based on observed residues (ATOM records): (download)

>d6cwga_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystgtqlptlarsfiiciqmiseaarfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrcapppssqf

SCOPe Domain Coordinates for d6cwga_:

Click to download the PDB-style file with coordinates for d6cwga_.
(The format of our PDB-style files is described here.)

Timeline for d6cwga_:

  • d6cwga_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17