SCOPe 2.07: Domain d6aktb_: 6akt B:

Lineage for d6aktb_ (6akt B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (15 species)
   not a true protein

7. Species Coxsackievirus a10 [TaxId:42769] [359971] (4 PDB entries)

8. Domain d6aktb_: 6akt B: [362088]
   Other proteins in same PDB: d6aktc_
   automated match to d4jgyb_

Details for d6aktb_

PDB Entry: 6akt, 2.8 Å

PDB Description: cryo-em structure of cva10 a-particle

PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d6aktb_:

Sequence, based on SEQRES records:

>d6aktb_ b.121.4.0 (B:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
aqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldskmwqe
nstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipefvia
grgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwinlrtnncat
vivpyinavpfdsainhsnfglivipvsplkyssgattaipititiaplnsefgglr

Sequence, based on observed residues (ATOM records):

>d6aktb_ b.121.4.0 (B:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
aqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldskmwqe
nstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipefvia
grgeaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwinlrtnncatvivpyi
navpfdsainhsnfglivipvsplkyssgattaipititiaplnsefgglr

Timeline for d6aktb_:

• d6aktb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17