SCOPe 2.07: Domain d6c2oa1: 6c2o A:1004-1179

Lineage for d6c2oa1 (6c2o A:1004-1179)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (8 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (14 PDB entries)

8. Domain d6c2oa1: 6c2o A:1004-1179 [362086]
   Other proteins in same PDB: d6c2oa2
   automated match to d5epna_
   complexed with gol, tsv, zn

Details for d6c2oa1

PDB Entry: 6c2o, 1.18 Å

PDB Description: crystal structure of hcv ns3/4a protease variant y56h in complex with danoprevir

PDB Compounds: (A:) NS3 protease

SCOPe Domain Sequences for d6c2oa1:

Sequence; same for both SEQRES and ATOM records:

>d6c2oa1 b.47.1.3 (A:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvhhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr
gsllsprpisylkgssggpllcpaghavgifraavstrgvakavdfipveslettm

Timeline for d6c2oa1:

• d6c2oa1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17