![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein automated matches [190658] (8 species) not a true protein |
![]() | Species Hepatitis C virus [TaxId:11103] [189262] (14 PDB entries) |
![]() | Domain d6c2oa1: 6c2o A:1004-1179 [362086] Other proteins in same PDB: d6c2oa2 automated match to d5epna_ complexed with gol, tsv, zn |
PDB Entry: 6c2o (more details), 1.18 Å
SCOPe Domain Sequences for d6c2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c2oa1 b.47.1.3 (A:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]} tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvhhgagtrt iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr gsllsprpisylkgssggpllcpaghavgifraavstrgvakavdfipveslettm
Timeline for d6c2oa1: