Lineage for d6d64a2 (6d64 A:184-278)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)
  8. 3062022Domain d6d64a2: 6d64 A:184-278 [362084]
    Other proteins in same PDB: d6d64a1, d6d64a3, d6d64b1, d6d64b2
    automated match to d3l9ra2
    complexed with bma, cl, cuy, edo, fuc, iod, man, na, nag, pov

Details for d6d64a2

PDB Entry: 6d64 (more details), 1.7 Å

PDB Description: crystal structure of human cd1b in complex with popc
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d6d64a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d64a2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr

SCOPe Domain Coordinates for d6d64a2:

Click to download the PDB-style file with coordinates for d6d64a2.
(The format of our PDB-style files is described here.)

Timeline for d6d64a2:

  • d6d64a2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17