Lineage for d6d64a1 (6d64 A:4-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937580Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)
  8. 2937583Domain d6d64a1: 6d64 A:4-183 [362083]
    Other proteins in same PDB: d6d64a2, d6d64a3, d6d64b1, d6d64b2
    automated match to d3l9ra1
    complexed with cl, cuy, edo, iod, na, pov

Details for d6d64a1

PDB Entry: 6d64 (more details), 1.7 Å

PDB Description: crystal structure of human cd1b in complex with popc
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d6d64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d64a1 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d6d64a1:

Click to download the PDB-style file with coordinates for d6d64a1.
(The format of our PDB-style files is described here.)

Timeline for d6d64a1: