SCOPe 2.07: Domain d6c3lb_: 6c3l B:

Lineage for d6c3lb_ (6c3l B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (27 PDB entries)

8. Domain d6c3lb_: 6c3l B: [362081]
   automated match to d1r2ba_
   complexed with egp

Details for d6c3lb_

PDB Entry: 6c3l, 1.46 Å

PDB Description: crystal structure of bcl6 btb domain with compound 15f

PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6c3lb_:

Sequence; same for both SEQRES and ATOM records:

>d6c3lb_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvvdtcrkf
ikas

Timeline for d6c3lb_:

• d6c3lb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17