Lineage for d6c44b_ (6c44 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341770Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2341771Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. 3048743Family a.190.1.0: automated matches [348805] (1 protein)
    not a true family
  6. 3048744Protein automated matches [348806] (3 species)
    not a true protein
  7. 3062014Species Zika virus [TaxId:64320] [362076] (1 PDB entry)
  8. 3062018Domain d6c44b_: 6c44 B: [362080]
    automated match to d1r6ra_

Details for d6c44b_

PDB Entry: 6c44 (more details)

PDB Description: zika virus capsid protein
PDB Compounds: (B:) capsid protein

SCOPe Domain Sequences for d6c44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c44b_ a.190.1.0 (B:) automated matches {Zika virus [TaxId: 64320]}
aglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfkkdlaamlri
inarkekkrr

SCOPe Domain Coordinates for d6c44b_:

Click to download the PDB-style file with coordinates for d6c44b_.
(The format of our PDB-style files is described here.)

Timeline for d6c44b_:

  • d6c44b_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from other chains:
(mouse over for more information)
d6c44a_