![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (143 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:99287] [362015] (1 PDB entry) |
![]() | Domain d6bl6a2: 6bl6 A:329-581 [362079] Other proteins in same PDB: d6bl6a1, d6bl6b1 automated match to d3b60a1 |
PDB Entry: 6bl6 (more details), 2.8 Å
SCOPe Domain Sequences for d6bl6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bl6a2 c.37.1.0 (A:329-581) automated matches {Salmonella enterica [TaxId: 99287]} degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq hgvyaqlhkmqfg
Timeline for d6bl6a2: