Lineage for d6bl6a1 (6bl6 A:7-328)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580483Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 2580484Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 2580485Family f.37.1.1: ABC transporter transmembrane region [90124] (4 proteins)
  6. 3051559Protein automated matches [351621] (2 species)
    not a true protein
  7. 3061947Species Salmonella enterica [TaxId:99287] [362009] (1 PDB entry)
  8. 3062016Domain d6bl6a1: 6bl6 A:7-328 [362078]
    Other proteins in same PDB: d6bl6a2, d6bl6b2
    automated match to d3b60a2

Details for d6bl6a1

PDB Entry: 6bl6 (more details), 2.8 Å

PDB Description: crystallization of lipid a transporter msba from salmonella typhimurium: a novel perspective on its transport
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d6bl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bl6a1 f.37.1.1 (A:7-328) automated matches {Salmonella enterica [TaxId: 99287]}
lstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgatdrsvllw
mplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtlls
ritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvs
krfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvs
assisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvna
qfqrgmaacqtlfaildseqek

SCOPe Domain Coordinates for d6bl6a1:

Click to download the PDB-style file with coordinates for d6bl6a1.
(The format of our PDB-style files is described here.)

Timeline for d6bl6a1:

  • d6bl6a1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6bl6a2