Lineage for d6cuge1 (6cug E:2-116)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1129 PDB entries)
  8. 3062009Domain d6cuge1: 6cug E:2-116 [362071]
    Other proteins in same PDB: d6cuga1, d6cugb_, d6cugd2
    automated match to d2axha1
    complexed with cl, cuy, nag, pov

Details for d6cuge1

PDB Entry: 6cug (more details), 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex
PDB Compounds: (E:) T-cell receptor beta variable TRBV6-2 - BC8B TCR

SCOPe Domain Sequences for d6cuge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuge1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
dgynvsrlkkqnfllglesaapsqtsvyfcassmpglrssyeqyfgpgtrltvte

SCOPe Domain Coordinates for d6cuge1:

Click to download the PDB-style file with coordinates for d6cuge1.
(The format of our PDB-style files is described here.)

Timeline for d6cuge1:

  • d6cuge1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17