Lineage for d6aksa_ (6aks A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (15 species)
    not a true protein
  7. 3059909Species Coxsackievirus a10 [TaxId:42769] [359971] (4 PDB entries)
  8. 3062008Domain d6aksa_: 6aks A: [362070]
    Other proteins in same PDB: d6aksc_
    automated match to d4cdqa_
    complexed with sph

Details for d6aksa_

PDB Entry: 6aks (more details), 3 Å

PDB Description: cryo-em structure of cva10 mature virus
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d6aksa_:

Sequence, based on SEQRES records: (download)

>d6aksa_ b.121.4.0 (A:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
dpvediihdalgstarraissatnvesaanttpsshrletgrvpalqaaetgatsnatde
nmietrcvvnrngvlettinhffsrsglvgvvnltdggtdttgyvtwdidimgfvqlrrk
cemftymrfnaeftfvtttkngearpymlqymyvppgapkptgrdafqwqtatnpsvfvk
ltdppaqvsvpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsrea
sqlklqtrvymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqan

Sequence, based on observed residues (ATOM records): (download)

>d6aksa_ b.121.4.0 (A:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
dpvediiraissatnvesaanttpsshrletgrvpalqaaetgatsnatdenmietrcvv
nrngvlettinhffsrsglvgvvnltdggtdttgyvtwdidimgfvqlrrkcemftymrf
naeftfvtttkngearpymlqymyvppgapkptgrdafqwqtatnpsvfvkltdppaqvs
vpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsreasqlklqtrv
ymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqan

SCOPe Domain Coordinates for d6aksa_:

Click to download the PDB-style file with coordinates for d6aksa_.
(The format of our PDB-style files is described here.)

Timeline for d6aksa_:

  • d6aksa_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17