Lineage for d6c1za1 (6c1z A:1-137)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396500Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2396501Protein automated matches [190698] (22 species)
    not a true protein
  7. 3062002Species Caenorhabditis elegans [TaxId:6239] [362064] (1 PDB entry)
  8. 3062003Domain d6c1za1: 6c1z A:1-137 [362065]
    Other proteins in same PDB: d6c1za2
    automated match to d4azpa_
    complexed with so4

Details for d6c1za1

PDB Entry: 6c1z (more details), 1.3 Å

PDB Description: crystal structure of apo caenorhabditis elegans lipid binding protein 8 (lbp-8)
PDB Compounds: (A:) Lipid binding protein

SCOPe Domain Sequences for d6c1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c1za1 b.60.1.0 (A:1-137) automated matches {Caenorhabditis elegans [TaxId: 6239]}
mvsmkefigrwklvhsenfeeylkeigvgllirkaasltsptleikldgdtwhfnqystf
knnklafkirekfveiapdersyntlvtfengkfishqdkikenhhssvfttwlengkll
qtyqsgsvicrrefvke

SCOPe Domain Coordinates for d6c1za1:

Click to download the PDB-style file with coordinates for d6c1za1.
(The format of our PDB-style files is described here.)

Timeline for d6c1za1:

  • d6c1za1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6c1za2