Lineage for d6c2na1 (6c2n A:990-1179)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389767Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2389857Protein automated matches [190658] (8 species)
    not a true protein
  7. 2389866Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (21 PDB entries)
  8. 3061994Domain d6c2na1: 6c2n A:990-1179 [362056]
    Other proteins in same PDB: d6c2na2
    automated match to d5epna_
    complexed with so4, tsv, zn; mutant

Details for d6c2na1

PDB Entry: 6c2n (more details), 1.8 Å

PDB Description: crystal structure of hcv ns3/4a double mutant variant y56h/d168a in complex with danoprevir
PDB Compounds: (A:) ns4a cofactor-ns3 protein chimera

SCOPe Domain Sequences for d6c2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2na1 b.47.1.3 (A:990-1179) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
gvlwtvhhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstrgvakavaf
ipveslettm

SCOPe Domain Coordinates for d6c2na1:

Click to download the PDB-style file with coordinates for d6c2na1.
(The format of our PDB-style files is described here.)

Timeline for d6c2na1:

  • d6c2na1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6c2na2