Lineage for d6cy8b2 (6cy8 B:229-380)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2317865Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2317999Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2318000Protein automated matches [226935] (29 species)
    not a true protein
  7. 3061988Species Marinomonas mediterranea [TaxId:717774] [362050] (2 PDB entries)
  8. 3061989Domain d6cy8b2: 6cy8 B:229-380 [362051]
    Other proteins in same PDB: d6cy8b1
    automated match to d3mpia2
    complexed with fad, pns

Details for d6cy8b2

PDB Entry: 6cy8 (more details), 2.73 Å

PDB Description: crystal structure of fad-dependent dehydrogenase
PDB Compounds: (B:) butyryl-coa dehydrogenase

SCOPe Domain Sequences for d6cy8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cy8b2 a.29.3.0 (B:229-380) automated matches {Marinomonas mediterranea [TaxId: 717774]}
gqgarifaasmdwercclfaifvgamqrdlnqcieyantrmqgdktisrfqavshriadm
gvrlesarlmlyyaawqksqdvdntkavamsklaiseafvqsgidsirvhgalgyldegr
vnnsikdalgsvlfsgtsdiqrelicnrlgll

SCOPe Domain Coordinates for d6cy8b2:

Click to download the PDB-style file with coordinates for d6cy8b2.
(The format of our PDB-style files is described here.)

Timeline for d6cy8b2:

  • d6cy8b2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17