Lineage for d6cugd2 (6cug D:115-187)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (854 PDB entries)
  8. 3061985Domain d6cugd2: 6cug D:115-187 [362047]
    Other proteins in same PDB: d6cuga1, d6cuga2, d6cugb_, d6cugd1, d6cuge1, d6cuge2
    automated match to d4eura2
    complexed with cl, cuy, nag, pov

Details for d6cugd2

PDB Entry: 6cug (more details), 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex
PDB Compounds: (D:) T-cell receptor alpha variable TRAV9-2 - BC8B TCR

SCOPe Domain Sequences for d6cugd2:

Sequence, based on SEQRES records: (download)

>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfaca

Sequence, based on observed residues (ATOM records): (download)

>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfaca

SCOPe Domain Coordinates for d6cugd2:

Click to download the PDB-style file with coordinates for d6cugd2.
(The format of our PDB-style files is described here.)

Timeline for d6cugd2:

  • d6cugd2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17