Lineage for d6c2ca_ (6c2c A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555838Family d.157.1.5: Methyl parathion hydrolase [111227] (2 proteins)
  6. 3061977Protein automated matches [362039] (1 species)
    not a true protein
  7. 3061978Species Pseudomonas sp. [TaxId:306] [362040] (1 PDB entry)
  8. 3061979Domain d6c2ca_: 6c2c A: [362041]
    automated match to d1p9ea_
    complexed with mg, peg, zn

Details for d6c2ca_

PDB Entry: 6c2c (more details), 1.6 Å

PDB Description: the molecular basis for the functional evolution of an organophosphate hydrolysing enzyme
PDB Compounds: (A:) dihydrocoumarin hydrolase, AncDHCH1

SCOPe Domain Sequences for d6c2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2ca_ d.157.1.5 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
gtigsmaaapqvktqapgfyrmmlgdfevtalsdgtvdlpvdkllnqppaktqsalaksf
lkapletsvnaylvntgsklvlvdtgaaglfgptlgklaanlkaagyqpeqvdeiyithm
hpdhvgglmaneqaafpnavvradqkdadfwlsqanldkapddekgffqgamaslnpyvk
agkfkpfsgntdlvpgikalashghtpghttyvveskgqklvllgdlihvaavqfddpsv
tiqfdsdskaaaaerkkafadaakggyligaahlsfpgighiradgkgyrfvpvnysva

SCOPe Domain Coordinates for d6c2ca_:

Click to download the PDB-style file with coordinates for d6c2ca_.
(The format of our PDB-style files is described here.)

Timeline for d6c2ca_:

  • d6c2ca_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17