Lineage for d6c45b_ (6c45 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790944Species Human (Homo sapiens) [TaxId:9606] [362022] (2 PDB entries)
  8. 2790947Domain d6c45b_: 6c45 B: [362038]
    automated match to d1e9gb_

Details for d6c45b_

PDB Entry: 6c45 (more details), 2.39 Å

PDB Description: crystal structure of human inorganic pyrophosphatase in the p212121 space group
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6c45b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c45b_ b.40.5.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiatk
dplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidvc
eigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgyl
eatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgiscm
nttlsespfkcdpdaaraivdalpppcesactvptdvdkwfh

SCOPe Domain Coordinates for d6c45b_:

Click to download the PDB-style file with coordinates for d6c45b_.
(The format of our PDB-style files is described here.)

Timeline for d6c45b_: