Lineage for d6c3ha_ (6c3h A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (78 species)
    not a true protein
  7. 2332094Species Rhodopseudomonas palustris [TaxId:316058] [193594] (17 PDB entries)
  8. 3061973Domain d6c3ha_: 6c3h A: [362035]
    automated match to d4egoa_
    complexed with cl, ejv, hem

Details for d6c3ha_

PDB Entry: 6c3h (more details), 1.71 Å

PDB Description: the crystal structure of 4-n-heptylbenzoate-bound cyp199a4
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6c3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c3ha_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d6c3ha_:

Click to download the PDB-style file with coordinates for d6c3ha_.
(The format of our PDB-style files is described here.)

Timeline for d6c3ha_:

  • d6c3ha_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17