SCOPe 2.07: Domain d6c5kb2: 6c5k B:108-214

Lineage for d6c5kb2 (6c5k B:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6c5kb2: 6c5k B:108-214 [362034]
   Other proteins in same PDB: d6c5kb1, d6c5kl1
   automated match to d1blna2
   complexed with fuc, gp1, kdo, nag, no3, z9m

Details for d6c5kb2

PDB Entry: 6c5k, 1.75 Å

PDB Description: s25-23 fab in complex with chlamydiaceae lps (crystal form 2)

PDB Compounds: (B:) IgG1 Fab Light Chain (Kappa)

SCOPe Domain Sequences for d6c5kb2:

Sequence; same for both SEQRES and ATOM records:

>d6c5kb2 b.1.1.2 (B:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d6c5kb2:

• d6c5kb2 is new in SCOPe 2.07-stable
  
• d6c5kb2 appears in the current release, SCOPe 2.08