Lineage for d6c5kb2 (6c5k B:108-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (550 PDB entries)
  8. 3061972Domain d6c5kb2: 6c5k B:108-214 [362034]
    Other proteins in same PDB: d6c5kb1, d6c5kl1
    automated match to d1blna2
    complexed with fuc, gp1, kdo, nag, no3, z9m

Details for d6c5kb2

PDB Entry: 6c5k (more details), 1.75 Å

PDB Description: s25-23 fab in complex with chlamydiaceae lps (crystal form 2)
PDB Compounds: (B:) IgG1 Fab Light Chain (Kappa)

SCOPe Domain Sequences for d6c5kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c5kb2 b.1.1.2 (B:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d6c5kb2:

Click to download the PDB-style file with coordinates for d6c5kb2.
(The format of our PDB-style files is described here.)

Timeline for d6c5kb2:

  • d6c5kb2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6c5kb1