Lineage for d6c3la_ (6c3l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513279Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2513280Species Human (Homo sapiens) [TaxId:9606] [102923] (26 PDB entries)
  8. 3061970Domain d6c3la_: 6c3l A: [362032]
    automated match to d1r2ba_
    complexed with egp

Details for d6c3la_

PDB Entry: 6c3l (more details), 1.46 Å

PDB Description: crystal structure of bcl6 btb domain with compound 15f
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6c3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c3la_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvvdtcrkf
ikas

SCOPe Domain Coordinates for d6c3la_:

Click to download the PDB-style file with coordinates for d6c3la_.
(The format of our PDB-style files is described here.)

Timeline for d6c3la_:

  • d6c3la_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17