Lineage for d6c45d_ (6c45 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384182Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2384183Protein automated matches [190523] (12 species)
    not a true protein
  7. 3061960Species Homo sapiens [TaxId:9606] [362022] (1 PDB entry)
  8. 3061962Domain d6c45d_: 6c45 D: [362024]
    automated match to d1e9gb_

Details for d6c45d_

PDB Entry: 6c45 (more details), 2.39 Å

PDB Description: crystal structure of human inorganic pyrophosphatase in the p212121 space group
PDB Compounds: (D:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6c45d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c45d_ b.40.5.0 (D:) automated matches {Homo sapiens [TaxId: 9606]}
fsteeraapfsleyrvflknekgqyispfhdipiyadkdvfhmvvevprwsnakmeiatk
dplnpikqdvkkgklryvanlfpykgyiwnygaipqtwedpghndkhtgccgdndpidvc
eigskvcargeiigvkvlgilamidegetdwkviainvddpdaanyndindvkrlkpgyl
eatvdwfrrykvpdgkpenefafnaefkdkdfaidiiksthdhwkalvtkktngkgiscm
nttlsespfkcdpdaaraivdalpppcesactvptdvdkwfh

SCOPe Domain Coordinates for d6c45d_:

Click to download the PDB-style file with coordinates for d6c45d_.
(The format of our PDB-style files is described here.)

Timeline for d6c45d_:

  • d6c45d_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17