Lineage for d6bl6b2 (6bl6 B:329-581)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 3061953Species Salmonella enterica [TaxId:99287] [362015] (1 PDB entry)
  8. 3061954Domain d6bl6b2: 6bl6 B:329-581 [362016]
    Other proteins in same PDB: d6bl6a1, d6bl6b1
    automated match to d3b60a1

Details for d6bl6b2

PDB Entry: 6bl6 (more details), 2.8 Å

PDB Description: crystallization of lipid a transporter msba from salmonella typhimurium: a novel perspective on its transport
PDB Compounds: (B:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d6bl6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bl6b2 c.37.1.0 (B:329-581) automated matches {Salmonella enterica [TaxId: 99287]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg

SCOPe Domain Coordinates for d6bl6b2:

Click to download the PDB-style file with coordinates for d6bl6b2.
(The format of our PDB-style files is described here.)

Timeline for d6bl6b2:

  • d6bl6b2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6bl6b1