Lineage for d6c00a_ (6c00 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2383613Protein automated matches [190915] (11 species)
    not a true protein
  7. 3061949Species Peptoclostridium difficile [TaxId:1496] [362011] (1 PDB entry)
  8. 3061950Domain d6c00a_: 6c00 A: [362012]
    automated match to d2n8na_

Details for d6c00a_

PDB Entry: 6c00 (more details)

PDB Description: solution structure of translation initiation factor 1 from clostridium difficile
PDB Compounds: (A:) Translation initiation factor IF-1

SCOPe Domain Sequences for d6c00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c00a_ b.40.4.5 (A:) automated matches {Peptoclostridium difficile [TaxId: 1496]}
makkdvielegtvsealpnamfkvklengheilchisgklrmnfirilegdkvnvelspy
dltrgritwrkk

SCOPe Domain Coordinates for d6c00a_:

Click to download the PDB-style file with coordinates for d6c00a_.
(The format of our PDB-style files is described here.)

Timeline for d6c00a_:

  • d6c00a_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-17