![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
![]() | Protein automated matches [190915] (11 species) not a true protein |
![]() | Species Peptoclostridium difficile [TaxId:1496] [362011] (1 PDB entry) |
![]() | Domain d6c00a_: 6c00 A: [362012] automated match to d2n8na_ |
PDB Entry: 6c00 (more details)
SCOPe Domain Sequences for d6c00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c00a_ b.40.4.5 (A:) automated matches {Peptoclostridium difficile [TaxId: 1496]} makkdvielegtvsealpnamfkvklengheilchisgklrmnfirilegdkvnvelspy dltrgritwrkk
Timeline for d6c00a_: