SCOP 1.69: Domain d1bsdb_: 1bsd B:

Lineage for d1bsdb_ (1bsd B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (34 PDB entries)

8. Domain d1bsdb_: 1bsd B: [36201]

Details for d1bsdb_

PDB Entry: 1bsd, 2.3 Å

PDB Description: crystal structural analysis of mutations in the hydrophobic cores of barnase

SCOP Domain Sequences for d1bsdb_:

Sequence; same for both SEQRES and ATOM records:

>d1bsdb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwlvykttdhyqtftkir

Timeline for d1bsdb_:

• d1bsdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bsdb_ appears in SCOP 1.67
  
• d1bsdb_ appears in SCOP 1.71
  
• d1bsdb_ appears in the current release, SCOPe 2.08