Lineage for d6al3a_ (6al3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733480Species Protobothrops flavoviridis [TaxId:88087] [362001] (1 PDB entry)
  8. 2733481Domain d6al3a_: 6al3 A: [362004]
    automated match to d1goda_
    complexed with so4

Details for d6al3a_

PDB Entry: 6al3 (more details), 2.57 Å

PDB Description: lys49 pla2 bpii derived from the venom of protobothrops flavoviridis.
PDB Compounds: (A:) Basic phospholipase A2 BP-II

SCOPe Domain Sequences for d6al3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6al3a_ a.133.1.2 (A:) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
tc

SCOPe Domain Coordinates for d6al3a_:

Click to download the PDB-style file with coordinates for d6al3a_.
(The format of our PDB-style files is described here.)

Timeline for d6al3a_: