Lineage for d6a7ia1 (6a7i A:1-407)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 3061936Species Streptomyces sp. [TaxId:1525753] [361998] (1 PDB entry)
  8. 3061937Domain d6a7ia1: 6a7i A:1-407 [361999]
    Other proteins in same PDB: d6a7ia2
    automated match to d1gwib_
    complexed with hem

Details for d6a7ia1

PDB Entry: 6a7i (more details), 2.19 Å

PDB Description: cyp154c4 from streptomyces sp. w2061
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6a7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a7ia1 a.104.1.1 (A:1-407) automated matches {Streptomyces sp. [TaxId: 1525753]}
mtrialdpfvrdldgesaalraagplaevelpggvhvyavtrhaearalltdsrvvkdid
vwnawrrgeipmdwpliglanpgrsmltvdgadhrrlrtlvaqaltvkrverlragieal
tnasleklaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqtpp
eevpqmmadlgalftkivdakrtnpgddltsaliaasengdhltdeeivntlqliiaagh
ettislivnvvealqthpeqrkkvlngeigwdgvieetlrwntptshvlirfatedievg
dkilpkgegliisfgalgrdeeqygptagefdatrtpnrhiafghgphvcpgaalsrlea
gialpalyerfpeldlavpasdlrnkpivtqndlhelpvklgcpfgg

SCOPe Domain Coordinates for d6a7ia1:

Click to download the PDB-style file with coordinates for d6a7ia1.
(The format of our PDB-style files is described here.)

Timeline for d6a7ia1:

  • d6a7ia1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17

View in 3D
Domains from same chain:
(mouse over for more information)
d6a7ia2