Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Vanderwaltozyma polyspora [TaxId:436907] [361945] (4 PDB entries) |
Domain d5z2xb_: 5z2x B: [361990] automated match to d4pvca_ complexed with edo, gol, nap, peg |
PDB Entry: 5z2x (more details), 1.98 Å
SCOPe Domain Sequences for d5z2xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z2xb_ c.2.1.0 (B:) automated matches {Vanderwaltozyma polyspora [TaxId: 436907]} msvlisgasgyiakhivrvlleqnykvigtvrsqdkadkllkqynnpnlsyeivpeianl dafddifkkhgkeikyvihaaspvnfgakdlekdlvipaingtknmfeaikkyapdtver vvmtasyasimtphrqndptltldeetwnpvteenayenvftaycasktfaekeawkfvk ensdavkfklttihpsfvfgpqnfdedvtkklnetceiingllhapfdtkvekthfsqfi dvrdvakthvlgfqkdelinqrlllcngafsqqdivnvfnedfpelkgqfppedkdtdln kgvtgckidnektkkllafeftpfhktihdtvyqilhkegrv
Timeline for d5z2xb_: